Evdenevenakliyatplatformu.web.tr Website Stats

evdenevenakliyatplatformu.web.tr
(Updated 3640 days ago)
Domain : evdenevenakliyatplatformu.web.tr
Domain Title : Evdenevenakliyatplatformu
WRPageWRPage : Complete In-Page SEO Analysis New Feature
WRScore WRScore(beta) is calculated on the basis of pageviews, unique visitors and unique content. :
evdenevenakliyatplatformu.web.tr Reviewed by WebRankStats on Dec 28 . Rating: Rating: 0.8 out of 10
Website IP : 93.89.224.20
Hosting Country : N/A

General Information

Meta Description :
Meta Keywords :
XML Sitemap :
Robots.txt :
Gzip Compress :
Text/HTML Ratio : 8.53%

Website Ranks

Alexa Rank : 986,403 visit Alexa
Compete Rank : N/A visit Compete
Quantcast Rank : N/A visit Quantcast

Website Safety

McAfee SiteAdvisor : green visit SiteAdvisor
WOT : Unknown visit WOT

Pages Indexed

Google : 516 visit Google
Bing : 0 visit Bing

Sociometer

Facebook Likes : 23
Stumbleupon : 0
LinkedIn : 0

HTTP Header Analysis

HTTP Header reponses of evdenevenakliyatplatformu.web.tr is the information we get when HTTP request sent to a server from connecting clients(e.g. chrome, firefox). When you input an address into your browser it sends a request to the server hosting the domain and the server responds. HTTP Header information is not directly displayed by normal web browsers like chrome, firefox etc.

HTTP/1.1 200 OK
Content-Type: text/html
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Sun, 28 Dec 2014 18:36:30 GMT
Connection: keep-alive
Content-Length: 25984

DNS Record Analysis

There are total 6 records in domain name system (DNS) of evdenevenakliyatplatformu.web.tr, which includes 1 Address(A) record, 1 Mail Exchange(MX) record, 2 Name Server(NS) records, 1 Start of Authority(SOA) record and 1 Text(TXT) record.

Host Name of the node to which this record pertains Type Type of resource record in symbolic representation. IP/Target TTL Count of seconds that the resource record stays valid. Extra Info Additional resource record-specific data
evdenevenakliyatplatformu.web.tr A Address Record: A 32-bit IPv4 address, most commonly used to map hostnames to an IP address of the host, but also used for DNSBLs, storing subnet masks in RFC 1101. 93.89.224.20 3600
evdenevenakliyatplatformu.web.tr MX Mail Exchange Record: Maps a domain name to a list of message transfer agents for that domain. mx01.evdenevenakliyatplatformu.web.tr 3600 pri: 10
evdenevenakliyatplatformu.web.tr NS Name Server Record: Delegates a DNS zone to use the given authoritative name servers. ns2.isimtescil.net 1969
evdenevenakliyatplatformu.web.tr NS Name Server Record: Delegates a DNS zone to use the given authoritative name servers. ns1.isimtescil.net 1969
evdenevenakliyatplatformu.web.tr SOA Start of Authority Record: Specifies authoritative information about a DNS zone, including the primary name server, the email of the domain administrator, the domain serial number, and several timers relating to refreshing the zone. 5479 mname: ns1.isimtescil.net
rname: hostmaster.evdenevenakliyatplatformu.web.tr
serial: 2014111117
refresh: 10800
retry: 3600
expire: 777600
minimum-ttl: 3600
evdenevenakliyatplatformu.web.tr TXT Text Record: Originally for arbitrary human-readable text in a DNS record. Since the early 1990s, however, this record more often carries machine-readable data, such as specified by RFC 1464, opportunistic encryption, Sender Policy Framework, DKIM, DMARC DNS-SD. 3600 txt: v=spf1 ip4:93.89.226.0/24 ip4:84.51.25.0/24 ?all
entries: Array

Traffic Graphs

Alexa Graph